PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g20270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 201aa    MW: 22299.7 Da    PI: 10.0643
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g20270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.86.5e-324298158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                +ep+YVNaKQy++Il+RRq Rak+e e+k  +k+rkpylheSRh+hA+rR+RgsgGrF
  CA01g20270 42 EEPVYVNAKQYHGILRRRQIRAKAELERKA-IKARKPYLHESRHQHAMRRARGSGGRF 98
                69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.1E-3640101IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.29141101IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.4E-274398IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.4E-244466IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068604666IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.4E-247598IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MLTPYPYPDM QYGGMMTYGA PVHPHLFEIH HARMPLPLDM EEEPVYVNAK QYHGILRRRQ  60
IRAKAELERK AIKARKPYLH ESRHQHAMRR ARGSGGRFLN TKKPNDKDHT PEETQKYGAT  120
IPTHSGNSSG SGSSDQGGKE GYTVQDMHKG DRHSFSTGNG HGSSVYFAQS AASEQGNGHY  180
SRGNWSLLVN QASQGAASRN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-2142122277NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-139HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016538310.11e-149PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
SwissprotQ945M96e-36NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLM1A9B51e-122M1A9B5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000176981e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112322025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.43e-36nuclear factor Y, subunit A1